(no subject)

Date: 2009-04-07 03:32 pm (UTC)
From: [identity profile] lafinjack.livejournal.com
"The summit where Tamatea, the man with the big knees, the climber of mountains, the land-swallower who travelled about, played his nose flute to his loved one."

Now that's a legacy to be proud of.

(no subject)

Date: 2009-04-07 04:43 pm (UTC)
From: [identity profile] gothpanda.livejournal.com
awww, I want a man who will play his nose-flute for me!

(no subject)

Date: 2009-04-07 05:23 pm (UTC)
From: [identity profile] sanityimpaired.livejournal.com
I just want a nose flute.

(no subject)

Date: 2009-04-07 09:13 pm (UTC)
ext_37422: three leds (useful arts)
From: [identity profile] dianavilliers.livejournal.com
Here ya go. (http://www.jadecarver.co.nz/instruments.html) Scroll down to the last one.

(no subject)

Date: 2009-04-07 03:32 pm (UTC)
From: [identity profile] lurkerwithout.livejournal.com
Aren't the kiwis the white New Zealanders? And wouldn't the sign be in non-Whitey?

(no subject)

Date: 2009-04-07 05:08 pm (UTC)
From: [identity profile] theweaselking.livejournal.com
While I was there, the Maori I met happily referred to themselves as Kiwis.

(no subject)

Date: 2009-04-07 09:16 pm (UTC)
From: [identity profile] lurkerwithout.livejournal.com
Useful to know...

(no subject)

Date: 2009-04-08 01:10 am (UTC)
From: [identity profile] harper-knight.livejournal.com
Kiwis is all of.. us? I'm not sure I count.

Pakeha is the Maori word for whitey, and yeah, when white kiwis wanna distinguish themselves from those other white people in other countries, they (we?) use it too. Even I have once or twice.

(no subject)

Date: 2009-04-07 03:51 pm (UTC)
ext_8707: Taken in front of Carnegie Hall (glyph)
From: [identity profile] ronebofh.livejournal.com
I guess that does look longer than the Welsh name that was making the rounds about ten years ago... ah, found it. Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.

(no subject)

Date: 2009-04-07 05:25 pm (UTC)
From: [identity profile] sanityimpaired.livejournal.com
From the above link:
" And finally, sadly even the 67 character allowance for a .com domain name is still insufficient for the town of Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu
in New Zealand with a staggering 92 characters however even this seems positively tiny compared to the town of

Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit

in Thailand which is a whopping 163 characters long so long that it doesn't even fit on one line! However whilst the New Zealand place name is recognised by the Guiness Book of Record, the Thailand name is not."

*Boggle*

(no subject)

Date: 2009-04-07 04:16 pm (UTC)
From: [identity profile] camilla-anna.livejournal.com
The natives were just messing with the explorers. It probably *really* means, "your finger, you fool!"

*laugh*

Date: 2009-04-07 05:19 pm (UTC)
From: [identity profile] ysabetwordsmith.livejournal.com
I love it! Doubtless the name is very descriptive if one reads Maori.

(no subject)

Date: 2009-04-07 05:29 pm (UTC)
ext_79676: (Default)
From: [identity profile] sola.livejournal.com
And the jinglemonkey in my head totally added: "~♫DOT.COM!♫~"

also in Wales - my grandmother is from here...

Date: 2009-04-07 10:07 pm (UTC)
From: [identity profile] faeriegigi.livejournal.com
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch

Meaning = "St. Mary's Church in the hollow of white hazel near a rapid whirlpool and the Church of St. Tysilio near the red cave."
From: [identity profile] faeriegigi.livejournal.com
looks like I wasnt first to mention...sry

(no subject)

Date: 2009-04-09 09:10 am (UTC)
From: [identity profile] siouxsyn.livejournal.com
Pretty sad when you feel the need to one-up the Welsh.

I wonder why the Thai name isn't accepted by the Guiness mob? Maybe it is sometimes spelled with spaces?

Profile

theweaselking: (Default)theweaselking
Page generated Mar. 31st, 2026 01:25 pm