"The summit where Tamatea, the man with the big knees, the climber of mountains, the land-swallower who travelled about, played his nose flute to his loved one."
Pakeha is the Maori word for whitey, and yeah, when white kiwis wanna distinguish themselves from those other white people in other countries, they (we?) use it too. Even I have once or twice.
From the above link: " And finally, sadly even the 67 character allowance for a .com domain name is still insufficient for the town of Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu in New Zealand with a staggering 92 characters however even this seems positively tiny compared to the town of
in Thailand which is a whopping 163 characters long so long that it doesn't even fit on one line! However whilst the New Zealand place name is recognised by the Guiness Book of Record, the Thailand name is not."
(no subject)
Date: 2009-04-07 03:32 pm (UTC)Now that's a legacy to be proud of.
(no subject)
Date: 2009-04-07 04:43 pm (UTC)(no subject)
Date: 2009-04-07 05:23 pm (UTC)(no subject)
Date: 2009-04-07 09:13 pm (UTC)(no subject)
Date: 2009-04-07 03:32 pm (UTC)(no subject)
Date: 2009-04-07 05:08 pm (UTC)(no subject)
Date: 2009-04-07 09:16 pm (UTC)(no subject)
Date: 2009-04-08 01:10 am (UTC)Pakeha is the Maori word for whitey, and yeah, when white kiwis wanna distinguish themselves from those other white people in other countries, they (we?) use it too. Even I have once or twice.
(no subject)
Date: 2009-04-07 03:51 pm (UTC)(no subject)
Date: 2009-04-07 05:25 pm (UTC)" And finally, sadly even the 67 character allowance for a .com domain name is still insufficient for the town of Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu
in New Zealand with a staggering 92 characters however even this seems positively tiny compared to the town of
Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit
in Thailand which is a whopping 163 characters long so long that it doesn't even fit on one line! However whilst the New Zealand place name is recognised by the Guiness Book of Record, the Thailand name is not."
*Boggle*
(no subject)
Date: 2009-04-07 04:16 pm (UTC)*laugh*
Date: 2009-04-07 05:19 pm (UTC)(no subject)
Date: 2009-04-07 05:29 pm (UTC)also in Wales - my grandmother is from here...
Date: 2009-04-07 10:07 pm (UTC)Meaning = "St. Mary's Church in the hollow of white hazel near a rapid whirlpool and the Church of St. Tysilio near the red cave."
Re: also in Wales - my grandmother is from here...
Date: 2009-04-07 10:07 pm (UTC)(no subject)
Date: 2009-04-09 09:10 am (UTC)I wonder why the Thai name isn't accepted by the Guiness mob? Maybe it is sometimes spelled with spaces?